Lineage for d1qleh_ (1qle H:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219983Species Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain [48840] (2 PDB entries)
  8. 219986Domain d1qleh_: 1qle H: [20209]
    Other proteins in same PDB: d1qlea_, d1qleb1, d1qleb2, d1qlec_, d1qled_

Details for d1qleh_

PDB Entry: 1qle (more details), 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment

SCOP Domain Sequences for d1qleh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qleh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain}
evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvssa

SCOP Domain Coordinates for d1qleh_:

Click to download the PDB-style file with coordinates for d1qleh_.
(The format of our PDB-style files is described here.)

Timeline for d1qleh_: