Lineage for d1qlel_ (1qle L:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547289Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547739Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)
  8. 547914Domain d1qlel_: 1qle L: [20208]
    Other proteins in same PDB: d1qlea_, d1qleb1, d1qleb2, d1qlec_, d1qled_, d1qleh_
    part of Fv against Paracoccus denitrificans cytochrome c oxidase

Details for d1qlel_

PDB Entry: 1qle (more details), 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment

SCOP Domain Sequences for d1qlel_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlel_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps
rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleik

SCOP Domain Coordinates for d1qlel_:

Click to download the PDB-style file with coordinates for d1qlel_.
(The format of our PDB-style files is described here.)

Timeline for d1qlel_: