![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
![]() | Species Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain [48840] (2 PDB entries) |
![]() | Domain d1ar1c_: 1ar1 C: [20207] Other proteins in same PDB: d1ar1a_, d1ar1b1, d1ar1b2 complexed with ca, cu, hea, lda, mg |
PDB Entry: 1ar1 (more details), 2.7 Å
SCOP Domain Sequences for d1ar1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ar1c_ b.1.1.1 (C:) Immunoglobulin (variable domains of L and H chains) {Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain} evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvss
Timeline for d1ar1c_:
![]() Domains from other chains: (mouse over for more information) d1ar1a_, d1ar1b1, d1ar1b2, d1ar1d_ |