SCOP 1.63: Domain d1ar1c_: 1ar1 C:

Lineage for d1ar1c_ (1ar1 C:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain [48840] (2 PDB entries)

8. Domain d1ar1c_: 1ar1 C: [20207]
   Other proteins in same PDB: d1ar1a_, d1ar1b1, d1ar1b2
   complexed with ca, cu, hea, lda, mg

Details for d1ar1c_

PDB Entry: 1ar1, 2.7 Å

PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment

SCOP Domain Sequences for d1ar1c_:

Sequence; same for both SEQRES and ATOM records:

>d1ar1c_ b.1.1.1 (C:) Immunoglobulin (variable domains of L and H chains) {Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain}
evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvss

Timeline for d1ar1c_:

• d1ar1c_ first appeared (with stable ids) in SCOP 1.55
  
• d1ar1c_ appears in SCOP 1.61
  
• d1ar1c_ appears in SCOP 1.65
  
• d1ar1c_ appears in the current release, SCOPe 2.08