Lineage for d1ar1c_ (1ar1 C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52579Species Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain [48840] (2 PDB entries)
  8. 52580Domain d1ar1c_: 1ar1 C: [20207]
    Other proteins in same PDB: d1ar1a1, d1ar1b1, d1ar1b2

Details for d1ar1c_

PDB Entry: 1ar1 (more details), 2.7 Å

PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment

SCOP Domain Sequences for d1ar1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ar1c_ b.1.1.1 (C:) Immunoglobulin (variable domains of L and H chains) {Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain}
evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvss

SCOP Domain Coordinates for d1ar1c_:

Click to download the PDB-style file with coordinates for d1ar1c_.
(The format of our PDB-style files is described here.)

Timeline for d1ar1c_: