Lineage for d1ar1d_ (1ar1 D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363836Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)
  8. 363957Domain d1ar1d_: 1ar1 D: [20206]
    Other proteins in same PDB: d1ar1a_, d1ar1b1, d1ar1b2, d1ar1c_
    part of Fv against Paracoccus denitrificans cytochrome c oxidase
    complexed with ca, cu, hea, lda, mg

Details for d1ar1d_

PDB Entry: 1ar1 (more details), 2.7 Å

PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment

SCOP Domain Sequences for d1ar1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ar1d_ b.1.1.1 (D:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps
rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleik

SCOP Domain Coordinates for d1ar1d_:

Click to download the PDB-style file with coordinates for d1ar1d_.
(The format of our PDB-style files is described here.)

Timeline for d1ar1d_: