SCOP 1.65: Domain d1ar1d_: 1ar1 D:

Lineage for d1ar1d_ (1ar1 D:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)

8. Domain d1ar1d_: 1ar1 D: [20206]
   Other proteins in same PDB: d1ar1a_, d1ar1b1, d1ar1b2, d1ar1c_
   part of Fv against Paracoccus denitrificans cytochrome c oxidase
   complexed with ca, cu, hea, lda, mg

Details for d1ar1d_

PDB Entry: 1ar1, 2.7 Å

PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment

SCOP Domain Sequences for d1ar1d_:

Sequence; same for both SEQRES and ATOM records:

>d1ar1d_ b.1.1.1 (D:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps
rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleik

Timeline for d1ar1d_:

• d1ar1d_ first appeared (with stable ids) in SCOP 1.55
  
• d1ar1d_ appears in SCOP 1.63
  
• d1ar1d_ appears in SCOP 1.67
  
• d1ar1d_ appears in the current release, SCOPe 2.08