Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [48839] (4 PDB entries) |
Domain d1d5bb1: 1d5b B:1-113 [20205] Other proteins in same PDB: d1d5ba2, d1d5bb2, d1d5bh2, d1d5bl2 |
PDB Entry: 1d5b (more details), 2.8 Å
SCOP Domain Sequences for d1d5bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5bb1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)} qvqlqqsgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
Timeline for d1d5bb1: