Lineage for d1d5bb1 (1d5b B:1-113)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) 
Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [48839] (4 PDB entries) 
Domain d1d5bb1: 1d5b B:1-113 [20205]
Other proteins in same PDB: d1d5ba2, d1d5bb2, d1d5bh2, d1d5bl2
Details for d1d5bb1
PDB Entry: 1d5b (more details), 2.8 Å
PDB Description: unliganded mature oxy-cope catalytic antibody
SCOP Domain Sequences for d1d5bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5bb1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
qvqlqqsgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
SCOP Domain Coordinates for d1d5bb1:
Click to download the PDB-style file with coordinates for d1d5bb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d5bb1:
View in 3D
