SCOPe 2.04: Domain d4fjvd_: 4fjv D:

Lineage for d4fjvd_ (4fjv D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Ubiquitin [54238] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54239] (126 PDB entries)
   Uniprot P62988
   identical sequence in many other species

8. Domain d4fjvd_: 4fjv D: [202038]
   Other proteins in same PDB: d4fjva_, d4fjvc_
   automated match to d4fjvb_
   complexed with gol, neh

Details for d4fjvd_

PDB Entry: 4fjv, 2.05 Å

PDB Description: Crystal Structure of Human Otubain2 and Ubiquitin Complex

PDB Compounds: (D:) Polyubiquitin-C

SCOPe Domain Sequences for d4fjvd_:

Sequence; same for both SEQRES and ATOM records:

>d4fjvd_ d.15.1.1 (D:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
dvpdyahmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
rtlsdyniqkestlhlvlrlrg

Timeline for d4fjvd_:

• d4fjvd_ first appeared in SCOPe 2.03
  
• d4fjvd_ appears in SCOPe 2.05
  
• d4fjvd_ appears in the current release, SCOPe 2.08, called d4fjvd1