Lineage for d4fjvc_ (4fjv C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1889673Family d.3.1.11: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110773] (2 proteins)
    probably the same as Pfam PF02338, OTU-like cysteine protease, but 1TFF (Uniprot Q96DC9) was not detected by the Pfam model
  6. 1889677Protein automated matches [197305] (1 species)
    not a true protein
  7. 1889678Species Human (Homo sapiens) [TaxId:9606] [197306] (1 PDB entry)
  8. 1889680Domain d4fjvc_: 4fjv C: [202037]
    Other proteins in same PDB: d4fjvb_, d4fjvd_
    automated match to d4fjva_
    complexed with gol, neh

Details for d4fjvc_

PDB Entry: 4fjv (more details), 2.05 Å

PDB Description: Crystal Structure of Human Otubain2 and Ubiquitin Complex
PDB Compounds: (C:) Ubiquitin thioesterase OTUB2

SCOPe Domain Sequences for d4fjvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fjvc_ d.3.1.11 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etsfnlisekcdilsilrdhpenriyrrkieelskrftairktkgdgncfyralgysyle
sllgksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvf
ndqsasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqita
lsqalsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaad

SCOPe Domain Coordinates for d4fjvc_:

Click to download the PDB-style file with coordinates for d4fjvc_.
(The format of our PDB-style files is described here.)

Timeline for d4fjvc_: