Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.11: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110773] (2 proteins) probably the same as Pfam PF02338, OTU-like cysteine protease, but 1TFF (Uniprot Q96DC9) was not detected by the Pfam model |
Protein automated matches [197305] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [197306] (13 PDB entries) |
Domain d4fjvc_: 4fjv C: [202037] Other proteins in same PDB: d4fjva2, d4fjvb1, d4fjvb2, d4fjvd1, d4fjvd2 automated match to d4fjva_ complexed with gol, neh |
PDB Entry: 4fjv (more details), 2.05 Å
SCOPe Domain Sequences for d4fjvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fjvc_ d.3.1.11 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} etsfnlisekcdilsilrdhpenriyrrkieelskrftairktkgdgncfyralgysyle sllgksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvf ndqsasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqita lsqalsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaad
Timeline for d4fjvc_: