SCOPe 2.06: Domain d4fh7b_: 4fh7 B:

Lineage for d4fh7b_ (4fh7 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (31 PDB entries)

8. Domain d4fh7b_: 4fh7 B: [202035]
   automated match to d1ew6a_
   complexed with hem, moh, oxy, so4, tbp

Details for d4fh7b_

PDB Entry: 4fh7, 1.74 Å

PDB Description: Structure of DHP A in complex with 2,4,6-tribromophenol in 20% methanol

PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d4fh7b_:

Sequence; same for both SEQRES and ATOM records:

>d4fh7b_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d4fh7b_:

• d4fh7b_ first appeared in SCOPe 2.03
  
• d4fh7b_ appears in SCOPe 2.05
  
• d4fh7b_ appears in SCOPe 2.07
  
• d4fh7b_ appears in the current release, SCOPe 2.08