Lineage for d4ffyl_ (4ffy L:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. Domain d4ffyl_: 4ffy L: [202034]
    Other proteins in same PDB: d4ffya_
    automated match to d1j05a_
    complexed with cl, gol, so4

Details for d4ffyl_

PDB Entry: 4ffy (more details), 2.5 Å

PDB Description: Crystal structure of DENV1-E111 single chain variable fragment bound to DENV-1 DIII, strain 16007.
PDB Compounds: (L:) DENV1-E111 single chain variable fragment (light chain)

SCOPe Domain Sequences for d4ffyl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffyl_ b.1.1.1 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nivltqspaslavslgqratiscrasesvdhygnsfiywyqqkpgqppklliylasnles
gvparfsgsgsetdftltidsvetddaatyycqqnnedpytfgggtkleikg

SCOPe Domain Coordinates for d4ffyl_ are not available.

Timeline for d4ffyl_:

Domains from other chains:
(mouse over for more information)
d4ffya_, d4ffyh_