SCOPe 2.04: Domain d4fc3e_: 4fc3 E:

Lineage for d4fc3e_ (4fc3 E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.0: automated matches [195425] (1 protein)
   not a true family

6. Protein automated matches [195426] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:196620] [226676] (2 PDB entries)

8. Domain d4fc3e_: 4fc3 E: [202027]
   Other proteins in same PDB: d4fc3a_, d4fc3b_
   automated match to d2h3ka1
   complexed with hem

Details for d4fc3e_

PDB Entry: 4fc3, 2.26 Å

PDB Description: crystal structure of human methaemoglobin complexed with the second neat domain of isdh from staphylococcus aureus

PDB Compounds: (E:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d4fc3e_:

Sequence; same for both SEQRES and ATOM records:

>d4fc3e_ b.1.28.0 (E:) automated matches {Staphylococcus aureus [TaxId: 196620]}
qqyppadeslqdaiknpaiidkehtadnwrpidfqmkndkgerqfyhyastvepatvift
ktgpiielglktastwkkfevyegdkklpvelvsydsdkdyayirfpvsngtrevkivss
ieygenihedydytlmvfaqpitn

Timeline for d4fc3e_:

• d4fc3e_ first appeared in SCOPe 2.03
  
• d4fc3e_ appears in SCOPe 2.05
  
• d4fc3e_ appears in the current release, SCOPe 2.08