Lineage for d4fc3e_ (4fc3 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766795Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2766841Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 2766842Protein automated matches [195426] (7 species)
    not a true protein
  7. 2766884Species Staphylococcus aureus [TaxId:196620] [226676] (2 PDB entries)
  8. 2766885Domain d4fc3e_: 4fc3 E: [202027]
    Other proteins in same PDB: d4fc3a_, d4fc3b_
    automated match to d2h3ka1
    complexed with hem

Details for d4fc3e_

PDB Entry: 4fc3 (more details), 2.26 Å

PDB Description: crystal structure of human methaemoglobin complexed with the second neat domain of isdh from staphylococcus aureus
PDB Compounds: (E:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d4fc3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fc3e_ b.1.28.0 (E:) automated matches {Staphylococcus aureus [TaxId: 196620]}
qqyppadeslqdaiknpaiidkehtadnwrpidfqmkndkgerqfyhyastvepatvift
ktgpiielglktastwkkfevyegdkklpvelvsydsdkdyayirfpvsngtrevkivss
ieygenihedydytlmvfaqpitn

SCOPe Domain Coordinates for d4fc3e_:

Click to download the PDB-style file with coordinates for d4fc3e_.
(The format of our PDB-style files is described here.)

Timeline for d4fc3e_: