Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.28: NEAT domain-like [158911] (2 families) |
Family b.1.28.0: automated matches [195425] (1 protein) not a true family |
Protein automated matches [195426] (7 species) not a true protein |
Species Staphylococcus aureus [TaxId:196620] [226676] (2 PDB entries) |
Domain d4fc3e_: 4fc3 E: [202027] Other proteins in same PDB: d4fc3a_, d4fc3b_ automated match to d2h3ka1 complexed with hem |
PDB Entry: 4fc3 (more details), 2.26 Å
SCOPe Domain Sequences for d4fc3e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fc3e_ b.1.28.0 (E:) automated matches {Staphylococcus aureus [TaxId: 196620]} qqyppadeslqdaiknpaiidkehtadnwrpidfqmkndkgerqfyhyastvepatvift ktgpiielglktastwkkfevyegdkklpvelvsydsdkdyayirfpvsngtrevkivss ieygenihedydytlmvfaqpitn
Timeline for d4fc3e_: