Lineage for d4fa8f_ (4fa8 F:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1486907Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1486908Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1486997Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1487141Protein automated matches [190501] (2 species)
    not a true protein
  7. 1487142Species Human (Homo sapiens) [TaxId:9606] [187448] (13 PDB entries)
  8. 1487161Domain d4fa8f_: 4fa8 F: [202023]
    automated match to d4fa8g_
    complexed with nag

Details for d4fa8f_

PDB Entry: 4fa8 (more details), 2.2 Å

PDB Description: Multi-pronged modulation of cytokine signaling
PDB Compounds: (F:) macrophage colony-stimulating factor 1

SCOPe Domain Sequences for d4fa8f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fa8f_ a.26.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdim
edtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvf
netknlldkdwnifskncnnsfaecs

SCOPe Domain Coordinates for d4fa8f_:

Click to download the PDB-style file with coordinates for d4fa8f_.
(The format of our PDB-style files is described here.)

Timeline for d4fa8f_: