Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein CD1, alpha-3 domain [88615] (5 species) |
Species Cow (Bos taurus) [TaxId:9913] [226527] (2 PDB entries) |
Domain d4f7cc2: 4f7c C:184-277 [202014] Other proteins in same PDB: d4f7ca1, d4f7ca3, d4f7cb_, d4f7cc1, d4f7cc3, d4f7cd_ automated match to d1gzqa1 complexed with 0sg |
PDB Entry: 4f7c (more details), 2.86 Å
SCOPe Domain Sequences for d4f7cc2:
Sequence, based on SEQRES records: (download)
>d4f7cc2 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Cow (Bos taurus) [TaxId: 9913]} qvkpeawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnadstw ylrvtldvaagevaglscqvkhsslgdqdiilyw
>d4f7cc2 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Cow (Bos taurus) [TaxId: 9913]} qvkpeawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnadstw ylrvtldvaglscqvkhsslgdqdiilyw
Timeline for d4f7cc2: