Lineage for d4f7cc2 (4f7c C:184-277)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358078Protein CD1, alpha-3 domain [88615] (5 species)
  7. 2358079Species Cow (Bos taurus) [TaxId:9913] [226527] (2 PDB entries)
  8. 2358082Domain d4f7cc2: 4f7c C:184-277 [202014]
    Other proteins in same PDB: d4f7ca1, d4f7ca3, d4f7cb_, d4f7cc1, d4f7cc3, d4f7cd_
    automated match to d1gzqa1
    complexed with 0sg

Details for d4f7cc2

PDB Entry: 4f7c (more details), 2.86 Å

PDB Description: crystal structure of bovine cd1d with bound c12-di-sulfatide
PDB Compounds: (C:) CD1D antigen, d polypeptide

SCOPe Domain Sequences for d4f7cc2:

Sequence, based on SEQRES records: (download)

>d4f7cc2 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Cow (Bos taurus) [TaxId: 9913]}
qvkpeawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnadstw
ylrvtldvaagevaglscqvkhsslgdqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d4f7cc2 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Cow (Bos taurus) [TaxId: 9913]}
qvkpeawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnadstw
ylrvtldvaglscqvkhsslgdqdiilyw

SCOPe Domain Coordinates for d4f7cc2:

Click to download the PDB-style file with coordinates for d4f7cc2.
(The format of our PDB-style files is described here.)

Timeline for d4f7cc2: