Lineage for d4f7cc1 (4f7c C:8-183)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1641764Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 1641765Species Cow (Bos taurus) [TaxId:9913] [226526] (2 PDB entries)
  8. 1641768Domain d4f7cc1: 4f7c C:8-183 [202013]
    Other proteins in same PDB: d4f7ca2, d4f7cb_, d4f7cc2, d4f7cd_
    automated match to d1gzpa2
    complexed with 0sg

Details for d4f7cc1

PDB Entry: 4f7c (more details), 2.86 Å

PDB Description: crystal structure of bovine cd1d with bound c12-di-sulfatide
PDB Compounds: (C:) CD1D antigen, d polypeptide

SCOPe Domain Sequences for d4f7cc1:

Sequence, based on SEQRES records: (download)

>d4f7cc1 d.19.1.1 (C:8-183) CD1, alpha-1 and alpha-2 domains {Cow (Bos taurus) [TaxId: 9913]}
fsfqglqissfanrswtrtdglawlgelqpytwrnesdtirflkpwsrgtfsdqqweqlq
htllvyrssftrdiwefveklhveypleiqiatgcellprnisesflraafqgrdvlsfq
gmswvsapdappfiqevikvlnqnqgtketvhwllhdiwpelvrgvlqtgkselek

Sequence, based on observed residues (ATOM records): (download)

>d4f7cc1 d.19.1.1 (C:8-183) CD1, alpha-1 and alpha-2 domains {Cow (Bos taurus) [TaxId: 9913]}
fsfqglqissfanrswtrtdglawlgelqpytwrnesdtirflkpwsrgtfsdqqweqlq
htllvyrssftrdiwefveklhveypleiqiatgcellsesflraafqgrdvlsfqgmsw
vsapdappfiqevikvlnqnqgtketvhwllhdiwpelvrgvlqtgkselek

SCOPe Domain Coordinates for d4f7cc1:

Click to download the PDB-style file with coordinates for d4f7cc1.
(The format of our PDB-style files is described here.)

Timeline for d4f7cc1: