Lineage for d4f7ca2 (4f7c A:184-279)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1514356Protein CD1, alpha-3 domain [88615] (5 species)
  7. 1514357Species Cow (Bos taurus) [TaxId:9913] [226527] (2 PDB entries)
  8. 1514359Domain d4f7ca2: 4f7c A:184-279 [202012]
    Other proteins in same PDB: d4f7ca1, d4f7cb_, d4f7cc1, d4f7cd_
    automated match to d1gzqa1
    complexed with 0sg

Details for d4f7ca2

PDB Entry: 4f7c (more details), 2.86 Å

PDB Description: Crystal structure of bovine CD1d with bound C12-di-sulfatide
PDB Compounds: (A:) CD1D antigen, d polypeptide

SCOPe Domain Sequences for d4f7ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7ca2 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Cow (Bos taurus) [TaxId: 9913]}
qvkpeawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnadstw
ylrvtldvaagevaglscqvkhsslgdqdiilywhh

SCOPe Domain Coordinates for d4f7ca2:

Click to download the PDB-style file with coordinates for d4f7ca2.
(The format of our PDB-style files is described here.)

Timeline for d4f7ca2: