SCOP 1.61: Domain d1axsa1: 1axs A:1-107

Lineage for d1axsa1 (1axs A:1-107)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [48839] (4 PDB entries)
Domain d1axsa1: 1axs A:1-107 [20200]
Other proteins in same PDB: d1axsa2, d1axsb2, d1axsh2, d1axsl2

Details for d1axsa1

PDB Entry: 1axs (more details), 2.6 Å

PDB Description: mature oxy-cope catalytic antibody with hapten

SCOP Domain Sequences for d1axsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axsa1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
elvltqspssmyaslgervtitckasqdinsylnwfqqkpgkspktliyrtnrlvdgvps
rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleik

SCOP Domain Coordinates for d1axsa1:

Click to download the PDB-style file with coordinates for d1axsa1.
(The format of our PDB-style files is described here.)

Timeline for d1axsa1: