Lineage for d1axsa1 (1axs A:1-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 8011Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [48839] (4 PDB entries)
  8. 8016Domain d1axsa1: 1axs A:1-107 [20200]
    Other proteins in same PDB: d1axsa2, d1axsb2, d1axsh2, d1axsl2

Details for d1axsa1

PDB Entry: 1axs (more details), 2.6 Å

PDB Description: mature oxy-cope catalytic antibody with hapten

SCOP Domain Sequences for d1axsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axsa1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
elvltqspssmyaslgervtitckasqdinsylnwfqqkpgkspktliyrtnrlvdgvps
rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleik

SCOP Domain Coordinates for d1axsa1:

Click to download the PDB-style file with coordinates for d1axsa1.
(The format of our PDB-style files is described here.)

Timeline for d1axsa1: