![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
![]() | Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [48839] (4 PDB entries) |
![]() | Domain d1axsl1: 1axs L:1-107 [20198] Other proteins in same PDB: d1axsa2, d1axsb2, d1axsh2, d1axsl2 |
PDB Entry: 1axs (more details), 2.6 Å
SCOP Domain Sequences for d1axsl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axsl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)} elvltqspssmyaslgervtitckasqdinsylnwfqqkpgkspktliyrtnrlvdgvps rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleik
Timeline for d1axsl1: