SCOPe 2.08: Domain d4f0ka1: 4f0k A:27-158

Lineage for d4f0ka1 (4f0k A:27-158)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Red algae (Galdieria sulphuraria) [TaxId:130081] [226524] (3 PDB entries)

8. Domain d4f0ka1: 4f0k A:27-158 [201979]
   Other proteins in same PDB: d4f0ka2, d4f0kb_
   automated match to d1bwva2
   complexed with cl, co2, gol, mg

Details for d4f0ka1

PDB Entry: 4f0k, 2.05 Å

PDB Description: unactivated rubisco with magnesium and carbon dioxide bound

PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d4f0ka1:

Sequence; same for both SEQRES and ATOM records:

>d4f0ka1 d.58.9.0 (A:27-158) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]}
pyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstatwtvvwtdlltaa
dlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvfgfkavkalrled
mrlpfayiktfq

Timeline for d4f0ka1:

• d4f0ka1 first appeared in SCOPe 2.03
  
• d4f0ka1 appears in SCOPe 2.07