Lineage for d4eu2u_ (4eu2 U:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1677317Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1677326Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (62 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1677386Domain d4eu2u_: 4eu2 U: [201970]
    Other proteins in same PDB: d4eu2a_, d4eu2c_, d4eu2d_, d4eu2e_, d4eu2f_, d4eu2g_, d4eu2i_, d4eu2j_, d4eu2o_, d4eu2s_
    automated match to d1jd21_
    complexed with wpi

Details for d4eu2u_

PDB Entry: 4eu2 (more details), 2.51 Å

PDB Description: Crystal structure of 20s proteasome with novel inhibitor K-7174
PDB Compounds: (U:) Proteasome component C1

SCOPe Domain Sequences for d4eu2u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eu2u_ d.153.1.4 (U:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d4eu2u_:

Click to download the PDB-style file with coordinates for d4eu2u_.
(The format of our PDB-style files is described here.)

Timeline for d4eu2u_: