SCOP 1.73: Domain d1d6vh1: 1d6v H:1-113

Lineage for d1d6vh1 (1d6v H:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1d6vh1: 1d6v H:1-113 [20197]
   Other proteins in same PDB: d1d6vh2, d1d6vl1, d1d6vl2
   part of humanized oxy-cope catalytic Fab az-28

Details for d1d6vh1

PDB Entry: 1d6v, 2 Å

PDB Description: conformation effects in biological catalysis introduced by oxy-cope antibody maturation

PDB Compounds: (H:) chimeric germline precursor of oxy-cope catalytic antibody az-28 (heavy chain)

SCOP Domain Sequences for d1d6vh1:

Sequence; same for both SEQRES and ATOM records:

>d1d6vh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgstny
nekfkgkatftadtssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss

Timeline for d1d6vh1:

• d1d6vh1 first appeared (with stable ids) in SCOP 1.55
  
• d1d6vh1 appears in SCOP 1.71
  
• d1d6vh1 appears in SCOP 1.75
  
• d1d6vh1 appears in the current release, SCOPe 2.08