Lineage for d1d6vh1 (1d6v H:1-113)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52717Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [48839] (4 PDB entries)
  8. 52720Domain d1d6vh1: 1d6v H:1-113 [20197]
    Other proteins in same PDB: d1d6vh2, d1d6vl2

Details for d1d6vh1

PDB Entry: 1d6v (more details), 2 Å

PDB Description: conformation effects in biological catalysis introduced by oxy-cope antibody maturation

SCOP Domain Sequences for d1d6vh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6vh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
qvqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgstny
nekfkgkatftadtssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss

SCOP Domain Coordinates for d1d6vh1:

Click to download the PDB-style file with coordinates for d1d6vh1.
(The format of our PDB-style files is described here.)

Timeline for d1d6vh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d6vh2