SCOPe 2.03: Domain d4eu2p_: 4eu2 P:

Lineage for d4eu2p_ (4eu2 P:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (50 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4eu2p_: 4eu2 P: [201966]
   Other proteins in same PDB: d4eu2a_, d4eu2c_, d4eu2d_, d4eu2e_, d4eu2f_, d4eu2g_, d4eu2i_, d4eu2j_, d4eu2o_, d4eu2s_
   automated match to d1jd2v_
   complexed with wpi

Details for d4eu2p_

PDB Entry: 4eu2, 2.51 Å

PDB Description: Crystal structure of 20s proteasome with novel inhibitor K-7174

PDB Compounds: (P:) Proteasome component Y7

SCOPe Domain Sequences for d4eu2p_:

Sequence; same for both SEQRES and ATOM records:

>d4eu2p_ d.153.1.4 (P:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrlea

Timeline for d4eu2p_:

• d4eu2p_ is new in SCOPe 2.03-stable
  
• d4eu2p_ appears in SCOPe 2.04
  
• d4eu2p_ appears in the current release, SCOPe 2.08