SCOP 1.65: Domain d1d6vl1: 1d6v L:1-107

Lineage for d1d6vl1 (1d6v L:1-107)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)

8. Domain d1d6vl1: 1d6v L:1-107 [20196]
   Other proteins in same PDB: d1d6vh1, d1d6vh2, d1d6vl2
   part of humanized oxy-cope catalytic Fab az-28

Details for d1d6vl1

PDB Entry: 1d6v, 2 Å

PDB Description: conformation effects in biological catalysis introduced by oxy-cope antibody maturation

SCOP Domain Sequences for d1d6vl1:

Sequence; same for both SEQRES and ATOM records:

>d1d6vl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dikmtqspssmyaslgervtitckasqdinsylswfqqkpgkspktliyranrlvdgvps
rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleik

Timeline for d1d6vl1:

• d1d6vl1 first appeared (with stable ids) in SCOP 1.55
  
• d1d6vl1 appears in SCOP 1.63
  
• d1d6vl1 appears in SCOP 1.67
  
• d1d6vl1 appears in the current release, SCOPe 2.08