SCOP 1.55: Domain d1d5ih1: 1d5i H:1-113

Lineage for d1d5ih1 (1d5i H:1-113)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [48839] (4 PDB entries)

8. Domain d1d5ih1: 1d5i H:1-113 [20195]
   Other proteins in same PDB: d1d5ih2, d1d5il2

Details for d1d5ih1

PDB Entry: 1d5i, 2 Å

PDB Description: unliganded germline precursor of an oxy-cope catalytic antibody

SCOP Domain Sequences for d1d5ih1:

Sequence; same for both SEQRES and ATOM records:

>d1d5ih1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
qvqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgstny
nekfkgkatftadtssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss

Timeline for d1d5ih1:

• d1d5ih1 appears in SCOP 1.57
  
• d1d5ih1 appears in the current release, SCOPe 2.08