SCOPe 2.03: Domain d4eosd2: 4eos D:310-429

Lineage for d4eosd2 (4eos D:310-429)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (73 PDB entries)
   Uniprot P20248 175-432

8. Domain d4eosd2: 4eos D:310-429 [201932]
   Other proteins in same PDB: d4eosa_, d4eosc_
   automated match to d1h1pb2
   complexed with 1ro

Details for d4eosd2

PDB Entry: 4eos, 2.57 Å

PDB Description: Thr 160 phosphorylated CDK2 WT - human cyclin A3 complex with the inhibitor RO3306

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4eosd2:

Sequence; same for both SEQRES and ATOM records:

>d4eosd2 a.74.1.1 (D:310-429) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet

Timeline for d4eosd2:

• d4eosd2 is new in SCOPe 2.03-stable
  
• d4eosd2 appears in SCOPe 2.04
  
• d4eosd2 appears in the current release, SCOPe 2.08