Lineage for d1aqkh1 (1aqk H:1-123)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102543Species Fab B7-15A2 (human), lambda L chain [48838] (1 PDB entry)
  8. 102544Domain d1aqkh1: 1aqk H:1-123 [20193]
    Other proteins in same PDB: d1aqkh2, d1aqkl2

Details for d1aqkh1

PDB Entry: 1aqk (more details), 1.84 Å

PDB Description: three-dimensional structure of a human fab with high affinity for tetanus toxoid

SCOP Domain Sequences for d1aqkh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqkh1 b.1.1.1 (H:1-123) Immunoglobulin (variable domains of L and H chains) {Fab B7-15A2 (human), lambda L chain}
evqlvesgggvvqpgrslrlscaasgftfnnyaihwvrqapgkglewvafisydgsknyy
adsvkgrftisrdnskntlflqmnslrpedtaiyycarvlfqqlvlyapfdiwgqgtmvt
vss

SCOP Domain Coordinates for d1aqkh1:

Click to download the PDB-style file with coordinates for d1aqkh1.
(The format of our PDB-style files is described here.)

Timeline for d1aqkh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aqkh2