SCOP 1.55: Domain d1aqkh1: 1aqk H:1-123

Lineage for d1aqkh1 (1aqk H:1-123)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab B7-15A2 (human), lambda L chain [48838] (1 PDB entry)

8. Domain d1aqkh1: 1aqk H:1-123 [20193]
   Other proteins in same PDB: d1aqkh2, d1aqkl2

Details for d1aqkh1

PDB Entry: 1aqk, 1.84 Å

PDB Description: three-dimensional structure of a human fab with high affinity for tetanus toxoid

SCOP Domain Sequences for d1aqkh1:

Sequence; same for both SEQRES and ATOM records:

>d1aqkh1 b.1.1.1 (H:1-123) Immunoglobulin (variable domains of L and H chains) {Fab B7-15A2 (human), lambda L chain}
evqlvesgggvvqpgrslrlscaasgftfnnyaihwvrqapgkglewvafisydgsknyy
adsvkgrftisrdnskntlflqmnslrpedtaiyycarvlfqqlvlyapfdiwgqgtmvt
vss

Timeline for d1aqkh1:

• d1aqkh1 appears in SCOP 1.57
  
• d1aqkh1 appears in the current release, SCOPe 2.08