| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Fab B7-15A2 (human), lambda L chain [48838] (1 PDB entry) |
| Domain d1aqkh1: 1aqk H:1-123 [20193] Other proteins in same PDB: d1aqkh2, d1aqkl2 |
PDB Entry: 1aqk (more details), 1.84 Å
SCOP Domain Sequences for d1aqkh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqkh1 b.1.1.1 (H:1-123) Immunoglobulin (variable domains of L and H chains) {Fab B7-15A2 (human), lambda L chain}
evqlvesgggvvqpgrslrlscaasgftfnnyaihwvrqapgkglewvafisydgsknyy
adsvkgrftisrdnskntlflqmnslrpedtaiyycarvlfqqlvlyapfdiwgqgtmvt
vss
Timeline for d1aqkh1: