SCOPe 2.04: Domain d4eoqd2: 4eoq D:310-429

Lineage for d4eoqd2 (4eoq D:310-429)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries)
   Uniprot P20248 175-432

8. Domain d4eoqd2: 4eoq D:310-429 [201923]
   Other proteins in same PDB: d4eoqa_, d4eoqc_
   automated match to d1h1pb2
   complexed with atp, mg, sgm

Details for d4eoqd2

PDB Entry: 4eoq, 2.15 Å

PDB Description: Thr 160 phosphorylated CDK2 WT - human cyclin A3 complex with ATP

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4eoqd2:

Sequence; same for both SEQRES and ATOM records:

>d4eoqd2 a.74.1.1 (D:310-429) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet

Timeline for d4eoqd2:

• d4eoqd2 first appeared in SCOPe 2.03
  
• d4eoqd2 appears in SCOPe 2.05
  
• d4eoqd2 appears in the current release, SCOPe 2.08