Lineage for d2h1ph1 (2h1p H:301-420)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219461Species Fab 2H1 (mouse), kappa L chain [48837] (1 PDB entry)
    polysaccharide binding antibody
  8. 219462Domain d2h1ph1: 2h1p H:301-420 [20191]
    Other proteins in same PDB: d2h1ph2, d2h1pl2

Details for d2h1ph1

PDB Entry: 2h1p (more details), 2.4 Å

PDB Description: the three-dimensional structures of a polysaccharide binding antibody to cryptococcus neoformans and its complex with a peptide from a phage display library: implications for the identification of peptide mimotopes

SCOP Domain Sequences for d2h1ph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1ph1 b.1.1.1 (H:301-420) Immunoglobulin (variable domains of L and H chains) {Fab 2H1 (mouse), kappa L chain}
dvklvesggglvklggslklscaasgftfssyflswvrqtpekrlelvatinsngdktyh
pdtmkgrftisrdnakntlylqmsslksedtalyycarrdssaslyfdywgqgttltvss

SCOP Domain Coordinates for d2h1ph1:

Click to download the PDB-style file with coordinates for d2h1ph1.
(The format of our PDB-style files is described here.)

Timeline for d2h1ph1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h1ph2