SCOP 1.55: Domain d2h1ph1: 2h1p H:301-420

Lineage for d2h1ph1 (2h1p H:301-420)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 2H1 (mouse), kappa L chain [48837] (1 PDB entry)

8. Domain d2h1ph1: 2h1p H:301-420 [20191]
   Other proteins in same PDB: d2h1ph2, d2h1pl2

Details for d2h1ph1

PDB Entry: 2h1p, 2.4 Å

PDB Description: the three-dimensional structures of a polysaccharide binding antibody to cryptococcus neoformans and its complex with a peptide from a phage display library: implications for the identification of peptide mimotopes

SCOP Domain Sequences for d2h1ph1:

Sequence; same for both SEQRES and ATOM records:

>d2h1ph1 b.1.1.1 (H:301-420) Immunoglobulin (variable domains of L and H chains) {Fab 2H1 (mouse), kappa L chain}
dvklvesggglvklggslklscaasgftfssyflswvrqtpekrlelvatinsngdktyh
pdtmkgrftisrdnakntlylqmsslksedtalyycarrdssaslyfdywgqgttltvss

Timeline for d2h1ph1:

• d2h1ph1 appears in SCOP 1.57
  
• d2h1ph1 appears in the current release, SCOPe 2.08