Class a: All alpha proteins [46456] (284 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (73 PDB entries) Uniprot P20248 175-432 |
Domain d4eokd2: 4eok D:310-431 [201900] Other proteins in same PDB: d4eoka_, d4eokc_ automated match to d1h1pb2 complexed with 4sp, sgm |
PDB Entry: 4eok (more details), 2.57 Å
SCOPe Domain Sequences for d4eokd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eokd2 a.74.1.1 (D:310-431) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet ln
Timeline for d4eokd2:
View in 3D Domains from other chains: (mouse over for more information) d4eoka_, d4eokb1, d4eokb2, d4eokc_ |