SCOP 1.61: Domain d2h1pl1: 2h1p L:1-113

Lineage for d2h1pl1 (2h1p L:1-113)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab 2H1 (mouse), kappa L chain [48837] (1 PDB entry)

8. Domain d2h1pl1: 2h1p L:1-113 [20190]
   Other proteins in same PDB: d2h1ph2, d2h1pl2

Details for d2h1pl1

PDB Entry: 2h1p, 2.4 Å

PDB Description: the three-dimensional structures of a polysaccharide binding antibody to cryptococcus neoformans and its complex with a peptide from a phage display library: implications for the identification of peptide mimotopes

SCOP Domain Sequences for d2h1pl1:

Sequence; same for both SEQRES and ATOM records:

>d2h1pl1 b.1.1.1 (L:1-113) Immunoglobulin (variable domains of L and H chains) {Fab 2H1 (mouse), kappa L chain}
dvvmtqtplslpvslgdpasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdkfsgsgsgtdftlkisrveaedqgvyfcsqsthvpwtfgggtkleikr

Timeline for d2h1pl1:

• d2h1pl1 first appeared (with stable ids) in SCOP 1.55
  
• d2h1pl1 appears in SCOP 1.59
  
• d2h1pl1 appears in SCOP 1.63
  
• d2h1pl1 appears in the current release, SCOPe 2.08