SCOP 1.63: Domain d1nfdh1: 1nfd H:1-114

Lineage for d1nfdh1 (1nfd H:1-114)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab H57 (hamster), lambda L chain [48836] (1 PDB entry)

8. Domain d1nfdh1: 1nfd H:1-114 [20189]
   Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde2, d1nfdf2, d1nfdg2, d1nfdh2
   complexed with nag

Details for d1nfdh1

PDB Entry: 1nfd, 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

SCOP Domain Sequences for d1nfdh1:

Sequence; same for both SEQRES and ATOM records:

>d1nfdh1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab H57 (hamster), lambda L chain}
evylvesggdlvqpgsslkvscaasgftfsdfwmywvrqapgkglewvgriknipnnyat
eyadsvrgrftisrddsrnsiylqmnrlrvddtaiyyctragrfdhfdywgqgtmvtvss
a

Timeline for d1nfdh1:

• d1nfdh1 first appeared (with stable ids) in SCOP 1.55
  
• d1nfdh1 appears in SCOP 1.61
  
• d1nfdh1 appears in SCOP 1.65
  
• d1nfdh1 appears in the current release, SCOPe 2.08