Lineage for d4en3c1 (4en3 C:8-183)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182598Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2182603Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (13 PDB entries)
  8. 2182606Domain d4en3c1: 4en3 C:8-183 [201882]
    Other proteins in same PDB: d4en3a1, d4en3a2, d4en3b1, d4en3b2, d4en3c2, d4en3d_
    automated match to d1onqa2
    complexed with agh, fuc, gol, nag

Details for d4en3c1

PDB Entry: 4en3 (more details), 2.57 Å

PDB Description: crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide
PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d4en3c1:

Sequence, based on SEQRES records: (download)

>d4en3c1 d.19.1.1 (C:8-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
fplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwetlq
hifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdilsfq
gtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

Sequence, based on observed residues (ATOM records): (download)

>d4en3c1 d.19.1.1 (C:8-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
fplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwetlq
hifrvyrssftrdvkefakmlrlsyplelqvsagcevhpasnnffhvafqgkdilsfqgt
sweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

SCOPe Domain Coordinates for d4en3c1:

Click to download the PDB-style file with coordinates for d4en3c1.
(The format of our PDB-style files is described here.)

Timeline for d4en3c1: