Lineage for d1nfdf1 (1nfd F:1-114)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2352673Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [88561] (1 PDB entry)
  8. 2352674Domain d1nfdf1: 1nfd F:1-114 [20187]
    Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde1, d1nfde2, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh2
    part of Fab H57
    complexed with nag, ndg

Details for d1nfdf1

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
PDB Compounds: (F:) h57 fab

SCOPe Domain Sequences for d1nfdf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfdf1 b.1.1.1 (F:1-114) Immunoglobulin heavy chain variable domain, VH {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
evylvesggdlvqpgsslkvscaasgftfsdfwmywvrqapgkglewvgriknipnnyat
eyadsvrgrftisrddsrnsiylqmnrlrvddtaiyyctragrfdhfdywgqgtmvtvss
a

SCOPe Domain Coordinates for d1nfdf1:

Click to download the PDB-style file with coordinates for d1nfdf1.
(The format of our PDB-style files is described here.)

Timeline for d1nfdf1: