Lineage for d4emme_ (4emm E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852296Protein Clp protease, ClpP subunit [52098] (11 species)
  7. 2852515Species Staphylococcus aureus [TaxId:196620] [189881] (4 PDB entries)
  8. 2852541Domain d4emme_: 4emm E: [201866]
    automated match to d4emma_

Details for d4emme_

PDB Entry: 4emm (more details), 2.4 Å

PDB Description: Crystal structure of Staphylococcus aureus ClpP in compact conformation
PDB Compounds: (E:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4emme_:

Sequence, based on SEQRES records: (download)

>d4emme_ c.14.1.1 (E:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]}
iptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyly
inspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmih
qplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakey
glidevmvp

Sequence, based on observed residues (ATOM records): (download)

>d4emme_ c.14.1.1 (E:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]}
iptvietraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspg
gsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplia
anhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp

SCOPe Domain Coordinates for d4emme_:

Click to download the PDB-style file with coordinates for d4emme_.
(The format of our PDB-style files is described here.)

Timeline for d4emme_: