Lineage for d1ap2d_ (1ap2 D:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782163Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 782192Domain d1ap2d_: 1ap2 D: [20185]
    Other proteins in same PDB: d1ap2a_, d1ap2c_
    part of P-glycoprotein-specific scFv C219

Details for d1ap2d_

PDB Entry: 1ap2 (more details), 2.36 Å

PDB Description: single chain fv of c219
PDB Compounds: (D:) monoclonal antibody c219

SCOP Domain Sequences for d1ap2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap2d_ b.1.1.1 (D:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
apkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvp
sgs

SCOP Domain Coordinates for d1ap2d_:

Click to download the PDB-style file with coordinates for d1ap2d_.
(The format of our PDB-style files is described here.)

Timeline for d1ap2d_: