Lineage for d1ap2d_ (1ap2 D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 8027Species scFv C219, (mouse sequence-based), kappa L chain [48835] (2 PDB entries)
  8. 8035Domain d1ap2d_: 1ap2 D: [20185]

Details for d1ap2d_

PDB Entry: 1ap2 (more details), 2.4 Å

PDB Description: single chain fv of c219

SCOP Domain Sequences for d1ap2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap2d_ b.1.1.1 (D:) Immunoglobulin (variable domains of L and H chains) {scFv C219, (mouse sequence-based), kappa L chain}
evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
apkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvp
sgs

SCOP Domain Coordinates for d1ap2d_:

Click to download the PDB-style file with coordinates for d1ap2d_.
(The format of our PDB-style files is described here.)

Timeline for d1ap2d_: