Lineage for d1ap2a_ (1ap2 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511793Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (46 PDB entries)
  8. 1511837Domain d1ap2a_: 1ap2 A: [20182]
    Other proteins in same PDB: d1ap2b_, d1ap2d_
    part of P-glycoprotein-specific scFv C219

Details for d1ap2a_

PDB Entry: 1ap2 (more details), 2.36 Å

PDB Description: single chain fv of c219
PDB Compounds: (A:) monoclonal antibody c219

SCOPe Domain Sequences for d1ap2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap2a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklep

SCOPe Domain Coordinates for d1ap2a_:

Click to download the PDB-style file with coordinates for d1ap2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ap2a_: