SCOP 1.69: Domain d1ap2a_: 1ap2 A:

Lineage for d1ap2a_ (1ap2 A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (34 PDB entries)

8. Domain d1ap2a_: 1ap2 A: [20182]
   Other proteins in same PDB: d1ap2b_, d1ap2d_

Details for d1ap2a_

PDB Entry: 1ap2, 2.4 Å

PDB Description: single chain fv of c219

SCOP Domain Sequences for d1ap2a_:

Sequence; same for both SEQRES and ATOM records:

>d1ap2a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2}
divmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklep

Timeline for d1ap2a_:

• d1ap2a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ap2a_ appears in SCOP 1.67
  
• d1ap2a_ appears in SCOP 1.71
  
• d1ap2a_ appears in the current release, SCOPe 2.08