Lineage for d1ap2a_ (1ap2 A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52733Species scFv C219, (mouse sequence-based), kappa L chain [48835] (2 PDB entries)
  8. 52738Domain d1ap2a_: 1ap2 A: [20182]

Details for d1ap2a_

PDB Entry: 1ap2 (more details), 2.4 Å

PDB Description: single chain fv of c219

SCOP Domain Sequences for d1ap2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap2a_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {scFv C219, (mouse sequence-based), kappa L chain}
divmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklep

SCOP Domain Coordinates for d1ap2a_:

Click to download the PDB-style file with coordinates for d1ap2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ap2a_: