SCOP 1.75: Domain d2ap2d_: 2ap2 D:

Lineage for d2ap2d_ (2ap2 D:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
   SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)

8. Domain d2ap2d_: 2ap2 D: [20181]
   Other proteins in same PDB: d2ap2a_, d2ap2c_
   part of P-glycoprotein-specific scFv C219

Details for d2ap2d_

PDB Entry: 2ap2, 2.4 Å

PDB Description: single chain fv of c219 in complex with synthetic epitope peptide

PDB Compounds: (D:) protein (antibody (heavy chain))

SCOP Domain Sequences for d2ap2d_:

Sequence; same for both SEQRES and ATOM records:

>d2ap2d_ b.1.1.1 (D:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
apkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvp
sg

Timeline for d2ap2d_:

• d2ap2d_ first appeared (with stable ids) in SCOP 1.55
  
• d2ap2d_ appears in SCOP 1.73
  
• d2ap2d_ appears in SCOPe 2.01
  
• d2ap2d_ last appears in SCOPe 2.07