Lineage for d2ap2c_ (2ap2 C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288992Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (46 PDB entries)
  8. 1289034Domain d2ap2c_: 2ap2 C: [20180]
    Other proteins in same PDB: d2ap2b_, d2ap2d_
    part of P-glycoprotein-specific scFv C219

Details for d2ap2c_

PDB Entry: 2ap2 (more details), 2.4 Å

PDB Description: single chain fv of c219 in complex with synthetic epitope peptide
PDB Compounds: (C:) protein (antibody (light chain))

SCOPe Domain Sequences for d2ap2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ap2c_ b.1.1.1 (C:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
fvrdivmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywa
stresgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklep

SCOPe Domain Coordinates for d2ap2c_:

Click to download the PDB-style file with coordinates for d2ap2c_.
(The format of our PDB-style files is described here.)

Timeline for d2ap2c_: