Lineage for d2ap2b_ (2ap2 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510890Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 1510914Domain d2ap2b_: 2ap2 B: [20179]
    Other proteins in same PDB: d2ap2a_, d2ap2c_
    part of P-glycoprotein-specific scFv C219

Details for d2ap2b_

PDB Entry: 2ap2 (more details), 2.4 Å

PDB Description: single chain fv of c219 in complex with synthetic epitope peptide
PDB Compounds: (B:) protein (antibody (heavy chain))

SCOPe Domain Sequences for d2ap2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ap2b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
apkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvp
sg

SCOPe Domain Coordinates for d2ap2b_:

Click to download the PDB-style file with coordinates for d2ap2b_.
(The format of our PDB-style files is described here.)

Timeline for d2ap2b_: