SCOPe 2.08: Domain d2ap2a1: 2ap2 A:1-234

Lineage for d2ap2a1 (2ap2 A:1-234)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (52 PDB entries)

8. Domain d2ap2a1: 2ap2 A:1-234 [20178]
   Other proteins in same PDB: d2ap2a2, d2ap2a3, d2ap2c2, d2ap2c3
   part of P-glycoprotein-specific scFv C219

Details for d2ap2a1

PDB Entry: 2ap2, 2.4 Å

PDB Description: single chain fv of c219 in complex with synthetic epitope peptide

PDB Compounds: (A:) single chain fv

SCOPe Domain Sequences for d2ap2a1:

Sequence, based on SEQRES records:

>d2ap2a1 b.1.1.1 (A:1-234) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklepggggsggg
gsgksggggevqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigri
dpandntkyapkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvw
gagttvtvpsg

Sequence, based on observed residues (ATOM records):

>d2ap2a1 b.1.1.1 (A:1-234) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklepevqlqqsg
aelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntkyapkfqdka
tiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvpsg

Timeline for d2ap2a1:

• d2ap2a1 first appeared (with stable ids) in SCOP 1.55, called d2ap2a_
  
• d2ap2a1 was called d2ap2a_ in SCOPe 2.07