Lineage for d1mf2n1 (1mf2 N:1-113)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (61 PDB entries)
Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
Domain d1mf2n1: 1mf2 N:1-113 [20177]
Other proteins in same PDB: d1mf2h2, d1mf2l1, d1mf2l2, d1mf2m1, d1mf2m2, d1mf2n2
part of Fab F11.2.32 against HIV-1 protease
Details for d1mf2n1
PDB Entry: 1mf2 (more details), 2.6 Å
PDB Description: anti hiv1 protease fab complex
PDB Compounds: (N:) monoclonal antibody f11.2.32SCOPe Domain Sequences for d1mf2n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mf2n1 b.1.1.1 (N:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
vtvss
SCOPe Domain Coordinates for d1mf2n1:
Click to download the PDB-style file with coordinates for d1mf2n1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mf2n1:
View in 3D
